PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G50060.1
Common NameF3A4.140, MYB77
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 301aa    MW: 33111.1 Da    PI: 6.3094
Description myb domain protein 77
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G50060.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.49.5e-20651147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEde+l + v+++G+++W++I++ ++ gR++k+c++rw + 
      AT3G50060.1  6 KGPWSQEEDEQLRRMVEKYGPRNWSAISKSIP-GRSGKSCRLRWCNQ 51
                     79******************************.***********985 PP

2Myb_DNA-binding53.26.8e-1760102347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++++eEde +v a +q+G++ W+tIar ++ gRt++ +k++w++ 
      AT3G50060.1  60 PFSPEEDETIVTARAQFGNK-WATIARLLN-GRTDNAVKNHWNST 102
                      89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.985156IPR017930Myb domain
SuperFamilySSF466892.08E-31399IPR009057Homeodomain-like
SMARTSM007173.2E-18554IPR001005SANT/Myb domain
PfamPF002492.2E-19651IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.1E-26759IPR009057Homeodomain-like
CDDcd001676.43E-18850No hitNo description
SMARTSM007174.2E-1457105IPR001005SANT/Myb domain
PROSITE profilePS5129419.23258107IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.5E-2260106IPR009057Homeodomain-like
CDDcd001671.90E-1160103No hitNo description
PfamPF002491.2E-1360102IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0010200Biological Processresponse to chitin
GO:0030154Biological Processcell differentiation
GO:0048527Biological Processlateral root development
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0003011anatomyroot vascular system
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020123anatomyroot cap
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025256anatomylateral root elongation zone
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MADRVKGPWS QEEDEQLRRM VEKYGPRNWS AISKSIPGRS GKSCRLRWCN QLSPEVEHRP  60
FSPEEDETIV TARAQFGNKW ATIARLLNGR TDNAVKNHWN STLKRKCSGG VAVTTVTETE  120
EDQDRPKKRR SVSFDSAFAP VDTGLYMSPE SPNGIDVSDS STIPSPSSPV AQLFKPMPIS  180
GGFTVVPQPL PVEMSSSSED PPTSLSLSLP GAENTSSSHN NNNNALMFPR FESQMKINVE  240
ERGEGRRGEF MTVVQEMIKA EVRSYMAEMQ KTSGGFVVGG LYESGGNGGF RDCGVITPKV  300
E
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-3951073105MYB PROTO-ONCOGENE PROTEIN
1mse_C3e-3951073105C-Myb DNA-Binding Domain
1msf_C3e-3951073105C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.226000.0flower| root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1865108600.0
Genevisible252193_at0.0
Expression AtlasAT3G50060-
AtGenExpressAT3G50060-
ATTED-IIAT3G50060-
Functional Description ? help Back to Top
Source Description
TAIREncodes a member of the R2R3 transcription factor gene family. Expressed in response to potassium deprivation and auxin. Involved in lateral root development. Interacts with ARF7 and regulates the expression of some auxin responsive genes.
Function -- GeneRIF ? help Back to Top
  1. A new Arabidopsis thaliana transcription factor, MYB77, that is involved in auxin response, is reported.
    [PMID: 17675404]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00400DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G50060.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid, auxin, ethylene, gibberellin, jasmonic acid, salicylic acid
Interaction ? help Back to Top
Source Intact With
BioGRIDAT3G50060, AT1G10585
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G50060
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4245880.0AF424588.1 Arabidopsis thaliana AT3g50060/F3A4_140 mRNA, complete cds.
GenBankAL1329780.0AL132978.1 Arabidopsis thaliana DNA chromosome 3, BAC clone F3A4.
GenBankAY1248280.0AY124828.1 Arabidopsis thaliana AT3g50060/F3A4_140 mRNA, complete cds.
GenBankAY5195980.0AY519598.1 Arabidopsis thaliana MYB transcription factor (At3g50060) mRNA, complete cds.
GenBankCP0026860.0CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_190575.10.0myb domain protein 77
SwissprotQ9FDW11e-110MYB44_ARATH; Transcription factor MYB44
TrEMBLQ9SN120.0Q9SN12_ARATH; AT3g50060/F3A4_140
STRINGAT3G50060.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM135981527
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Menges M,Hennig L,Gruissem W,Murray JA
    Cell cycle-regulated gene expression in Arabidopsis.
    J. Biol. Chem., 2002. 277(44): p. 41987-2002
    [PMID:12169696]
  4. Kersten B, et al.
    Generation of Arabidopsis protein chips for antibody and serum screening.
    Plant Mol. Biol., 2003. 52(5): p. 999-1010
    [PMID:14558660]
  5. Shin R,Schachtman DP
    Hydrogen peroxide mediates plant root cell response to nutrient deprivation.
    Proc. Natl. Acad. Sci. U.S.A., 2004. 101(23): p. 8827-32
    [PMID:15173595]
  6. Ko JH,Han KH,Park S,Yang J
    Plant body weight-induced secondary growth in Arabidopsis and its transcription phenotype revealed by whole-transcriptome profiling.
    Plant Physiol., 2004. 135(2): p. 1069-83
    [PMID:15194820]
  7. Teige M, et al.
    The MKK2 pathway mediates cold and salt stress signaling in Arabidopsis.
    Mol. Cell, 2004. 15(1): p. 141-52
    [PMID:15225555]
  8. Guan Y,Nothnagel EA
    Binding of arabinogalactan proteins by Yariv phenylglycoside triggers wound-like responses in Arabidopsis cell cultures.
    Plant Physiol., 2004. 135(3): p. 1346-66
    [PMID:15235117]
  9. Lee D,Polisensky DH,Braam J
    Genome-wide identification of touch- and darkness-regulated Arabidopsis genes: a focus on calmodulin-like and XTH genes.
    New Phytol., 2005. 165(2): p. 429-44
    [PMID:15720654]
  10. Suzuki N, et al.
    Enhanced tolerance to environmental stress in transgenic plants expressing the transcriptional coactivator multiprotein bridging factor 1c.
    Plant Physiol., 2005. 139(3): p. 1313-22
    [PMID:16244138]
  11. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  12. Ma S,Gong Q,Bohnert HJ
    Dissecting salt stress pathways.
    J. Exp. Bot., 2006. 57(5): p. 1097-107
    [PMID:16510518]
  13. Zheng W, et al.
    Bestatin, an inhibitor of aminopeptidases, provides a chemical genetics approach to dissect jasmonate signaling in Arabidopsis.
    Plant Physiol., 2006. 141(4): p. 1400-13
    [PMID:16798948]
  14. Shin R, et al.
    The Arabidopsis transcription factor MYB77 modulates auxin signal transduction.
    Plant Cell, 2007. 19(8): p. 2440-53
    [PMID:17675404]
  15. Libault M,Wan J,Czechowski T,Udvardi M,Stacey G
    Identification of 118 Arabidopsis transcription factor and 30 ubiquitin-ligase genes responding to chitin, a plant-defense elicitor.
    Mol. Plant Microbe Interact., 2007. 20(8): p. 900-11
    [PMID:17722694]
  16. Ferreira FJ,Guo C,Coleman JR
    Reduction of plastid-localized carbonic anhydrase activity results in reduced Arabidopsis seedling survivorship.
    Plant Physiol., 2008. 147(2): p. 585-94
    [PMID:18434607]
  17. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  18. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  19. Causier B,Ashworth M,Guo W,Davies B
    The TOPLESS interactome: a framework for gene repression in Arabidopsis.
    Plant Physiol., 2012. 158(1): p. 423-38
    [PMID:22065421]
  20. Lumba S, et al.
    A mesoscale abscisic acid hormone interactome reveals a dynamic signaling landscape in Arabidopsis.
    Dev. Cell, 2014. 29(3): p. 360-72
    [PMID:24823379]
  21. Zhao Y, et al.
    The ABA receptor PYL8 promotes lateral root growth by enhancing MYB77-dependent transcription of auxin-responsive genes.
    Sci Signal, 2014. 7(328): p. ra53
    [PMID:24894996]
  22. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]